PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca56652.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family GATA
Protein Properties Length: 140aa    MW: 15268.8 Da    PI: 9.8754
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca56652.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.15.1e-183973135
        GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                C +C + kTp+WR gp g+ktLCnaCG++y++ +l
  Dca56652.1 39 CLHCASEKTPQWRAGPHGPKTLCNACGVRYKSGRL 73
                99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577164.09E-143388No hitNo description
SMARTSM004018.0E-163383IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.7E-143571IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.8333669IPR000679Zinc finger, GATA-type
CDDcd002022.62E-123886No hitNo description
PfamPF003202.8E-163973IPR000679Zinc finger, GATA-type
PROSITE patternPS0034403964IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MWFECWKKKK TASVLSSSSL KPTTKSSVGG SSIGIGRKCL HCASEKTPQW RAGPHGPKTL  60
CNACGVRYKS GRLVPEYRPA SSPTFSSETV LELVAVYISD SVSSCLQGLC FGLKLNHLVF  120
LSLRCAICLQ NVARKERTVE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010025821.13e-31PREDICTED: GATA transcription factor 1, partial
TrEMBLA0A059ATX33e-31A0A059ATX3_EUCGR; Uncharacterized protein (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.16e-30GATA transcription factor 9